PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_7F3ABFDD6.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 325aa    MW: 34838.2 Da    PI: 9.4509
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_7F3ABFDD6.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA97.91.1e-30164220158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            d+p+YVNaKQy++Il+RR +Rak+e+e++l  k+rkpylheSRh+hA+rR+Rg+gGrF
  Traes_5DL_7F3ABFDD6.1 164 DAPIYVNAKQYEGILRRRRARAKVERENQL-VKGRKPYLHESRHRHAMRRARGTGGRF 220
                            68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.1E-34162223IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.172163223IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.1E-27166220IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.7E-24166188IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.7E-24197220IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MMSFKGHDGF GQASNGGGGG GAPVPWWTVS QMLYGEPGAA LSSSPEPEVR RDGQFQVVPR  60
AQGILDPAPP APKGGAPEVL KFSVFQGNLE SGGNKGEKAL VHSATIALQS PLPEYNGRFE  120
FGPGPSMMSS GYPSADQCYG LLTTYAMKST PGSRLLLPLN ATADAPIYVN AKQYEGILRR  180
RRARAKVERE NQLVKGRKPY LHESRHRHAM RRARGTGGRF LNTKKEGDGK DAPGGGKRAD  240
CTPPTRFATS PSSVIPHSRS SISSLSGSEV SSMYDHDDVD HYNSIEHLRT PFFTPLPIIM  300
DGEHGASAPF KWATAADGCC ELLKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-19164233267NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1204213RHRHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090630.0BT009063.1 Triticum aestivum clone wds1f.pk002.p21:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561845.11e-167PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLW5FV740.0W5FV74_WHEAT; Uncharacterized protein
STRINGBRADI1G13680.11e-167(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.12e-24nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]